PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g026070.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 808aa    MW: 87936.6 Da    PI: 6.5452
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g026070.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81e-19115169256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +k +++t++q++eLe++F+++++p++++r eL k+l L+ rqVk+WFqNrR+++k
  Sopim03g026070.0.1 115 KKYHRHTPYQIQELEAFFKESPHPDEKARLELGKRLTLESRQVKFWFQNRRTQMK 169
                         78899***********************************************999 PP

2START149.14.1e-473225441205
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela + ++el+k+a+ ++p+W        e +n +e+ ++f++  +     ++ ea +a+g v  ++ +lve+l+d++ +W   +     k
  Sopim03g026070.0.1 322 ELAFASMNELIKLADIGAPLWLGNFdgtaEVLNLEEYARSFPPCIGikpahFTAEATKATGTVMINSLTLVETLMDTS-RWMDIFScivgK 411
                         578999****************999899999************9999*******************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          +t++vis+       g  ql++ae+q++s lvp R + f+R+++q+ +g+wv vdvS+d  q+ p  +    +++lpSg+++++++ng s
  Sopim03g026070.0.1 412 TSTINVISNSsggskdGNMQLIQAEFQVPSALVPvRRVKFLRFCKQHAEGVWVMVDVSIDAIQEGPV-PLDGSCRRLPSGCIVQELPNGCS 501
                         ********99999*****************************************************6.66666679*************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         kv+w+eh+++++++ h+++++ ++sgl +ga++w atlqrqce
  Sopim03g026070.0.1 502 KVIWIEHMEYDESVTHNYYHPYIRSGLGFGAQRWIATLQRQCE 544
                         ******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.11E-18101171IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-21109179IPR009057Homeodomain-like
PROSITE profilePS5007116.86111171IPR001356Homeobox domain
SMARTSM003891.3E-15113175IPR001356Homeobox domain
CDDcd000862.29E-16115172No hitNo description
PfamPF000462.3E-17115169IPR001356Homeobox domain
PROSITE profilePS5084835.777313548IPR002913START domain
SuperFamilySSF559613.71E-26315544No hitNo description
CDDcd088758.06E-104317544No hitNo description
SMARTSM002348.4E-30322545IPR002913START domain
PfamPF018526.5E-40323544IPR002913START domain
SuperFamilySSF559614.67E-8617774No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
MSFGGFIGSS SGGNGGGVSR LVGDTSYEAM PTATMAQSQL ITSSLSHSMF NSSPLSLALK  60
PKMEGSGDLS FDGMGRNSRD DEYESRSGTG SDNFDGVGSG DEIETHIGSS SKSAKKYHRH  120
TPYQIQELEA FFKESPHPDE KARLELGKRL TLESRQVKFW FQNRRTQMKT QMERHENSML  180
KQENDKLRIE NIAMKEAMRS PACPHCGGQA ILGEIHIEEH HLKIENARLR DEYSRICVVA  240
NKFLGRQVES VHGPMSAGMA NSGLELAVGR NGYGAMNSVD TALPMGLNFG NNFSSALPAI  300
SPRPALSMAG VDVSFDRNML MELAFASMNE LIKLADIGAP LWLGNFDGTA EVLNLEEYAR  360
SFPPCIGIKP AHFTAEATKA TGTVMINSLT LVETLMDTSR WMDIFSCIVG KTSTINVISN  420
SSGGSKDGNM QLIQAEFQVP SALVPVRRVK FLRFCKQHAE GVWVMVDVSI DAIQEGPVPL  480
DGSCRRLPSG CIVQELPNGC SKVIWIEHME YDESVTHNYY HPYIRSGLGF GAQRWIATLQ  540
RQCEFITVMS SPVPSGDNSV LSSSGRRSIA MLARRITRHF CNGVCATYYK WESIQLGTAE  600
ESKFIMRKGV GEPGDLNGMV LSASRTLWLP ITHQRLSDFL RNEQTRGQWD VLSQGGSVHR  660
IVHIAKGQDP GNSITLFRTT VANSDGSQNG LLTLQESCTD VSGSIIAYTS LNTGDMNGVM  720
NGGDSSCVTF LPSGFAMVPD CYENSNGVAG IGTLENGGKM NGCLLTMGYQ VLMSNPPTGN  780
LTMDSVNTVD SLITRTVHNI KLAFQCN*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234441.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
TrEMBLK4BF800.0K4BF80_SOLLC; Uncharacterized protein
STRINGSolyc03g026070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein